GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002387-TA|BGIBMGA002387-PA|undefined
         (93 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    20   5.9  

>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 19.8 bits (39), Expect = 5.9
 Identities = 9/39 (23%), Positives = 19/39 (48%)

Query: 10  SRQHSQACLNTSLSIRQEIQRFESVHPSIYALYDLVELV 48
           ++ +S  CLN  +  R+ I    +    + +++D  E V
Sbjct: 289 AQTNSMICLNGQVLKRESIHNSSNARFLMDSMFDFAERV 327


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.134    0.394 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,964
Number of Sequences: 429
Number of extensions: 659
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 93
length of database: 140,377
effective HSP length: 48
effective length of query: 45
effective length of database: 119,785
effective search space:  5390325
effective search space used:  5390325
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.6 bits)
S2: 38 (19.4 bits)