GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002385-TA|BGIBMGA002385-PA|undefined
         (354 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74)           31   1.4  

>SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74)
          Length = 483

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 287 HIPYPVEKAVPFPVNIPVDRPYPVHIEKHVPVH 319
           H P+PV   V  P  +PV  P PV +   VP+H
Sbjct: 212 HHPFPVRVPVRVPFRVPVRVPVPVRVP--VPIH 242


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.142    0.441 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,989,282
Number of Sequences: 59808
Number of extensions: 78723
Number of successful extensions: 303
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 300
Number of HSP's gapped (non-prelim): 4
length of query: 354
length of database: 16,821,457
effective HSP length: 83
effective length of query: 271
effective length of database: 11,857,393
effective search space: 3213353503
effective search space used: 3213353503
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 61 (28.7 bits)