GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002375-TA|BGIBMGA002375-PA|IPR011046|WD40-like,
IPR001680|WD-40 repeat
         (672 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle pr...    23   6.8  

>AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle
           protein.
          Length = 361

 Score = 23.0 bits (47), Expect = 6.8
 Identities = 11/42 (26%), Positives = 17/42 (40%)

Query: 53  IDEMLSSLGVAPVKDVXXXXXXXXXXXPPQTASPDASLPHTD 94
           +D ML + GVA  +               Q   PD ++ H+D
Sbjct: 105 LDNMLIAEGVAGPEKGGGAGAAASGSAAAQAGQPDNAIEHSD 146


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.316    0.131    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,861
Number of Sequences: 317
Number of extensions: 5634
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 672
length of database: 114,650
effective HSP length: 61
effective length of query: 611
effective length of database: 95,313
effective search space: 58236243
effective search space used: 58236243
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)