GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002375-TA|BGIBMGA002375-PA|IPR011046|WD40-like,
IPR001680|WD-40 repeat
         (672 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    23   8.1  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 11/41 (26%), Positives = 19/41 (46%)

Query: 430 CSWSLDMLSQPQETLELQHRQAKPVAVTCMDCPQTMLNNFV 470
           C++ +DM S   E  E +    +  AV  M+  +  L  F+
Sbjct: 189 CAFGIDMSSMTNENSEFRRMGREVFAVNFMNVMRMKLKQFM 229


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.131    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,109
Number of Sequences: 429
Number of extensions: 6770
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 672
length of database: 140,377
effective HSP length: 62
effective length of query: 610
effective length of database: 113,779
effective search space: 69405190
effective search space used: 69405190
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 47 (23.0 bits)