GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002362-TA|BGIBMGA002362-PA|IPR000618|Insect cuticle
protein
         (173 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450 ...    25   0.34 

>AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 463

 Score = 25.0 bits (52), Expect = 0.34
 Identities = 11/38 (28%), Positives = 21/38 (55%)

Query: 64  LVQPDGVHRIVEYTSDKVNGFNANVRYEGHPVAQPAKI 101
           +V+PD +H ++E    K+   N+N   EG    + ++I
Sbjct: 218 IVRPDLIHLLMEARKGKLKHDNSNEGGEGFATVEESEI 255


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.316    0.129    0.373 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,881
Number of Sequences: 317
Number of extensions: 1039
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 173
length of database: 114,650
effective HSP length: 53
effective length of query: 120
effective length of database: 97,849
effective search space: 11741880
effective search space used: 11741880
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
S2: 40 (20.2 bits)