SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002362-TA|BGIBMGA002362-PA|IPR000618|Insect cuticle
protein
         (173 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0765 - 27910189-27912393,27912521-27912598                       27   8.2  

>04_04_0765 - 27910189-27912393,27912521-27912598
          Length = 760

 Score = 27.1 bits (57), Expect = 8.2
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 131 VAKIAYSAPIAKVAYAAPVAKIAYNSAPLTQVTFSSPAIS 170
           VA    +AP A VA  +PVA +A  S+P      SSPA S
Sbjct: 403 VAAAGSTAP-AVVAPDSPVAAVAVFSSPTAVAASSSPAAS 441


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.316    0.129    0.373 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,893,572
Number of Sequences: 37544
Number of extensions: 126399
Number of successful extensions: 260
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 260
Number of HSP's gapped (non-prelim): 1
length of query: 173
length of database: 14,793,348
effective HSP length: 77
effective length of query: 96
effective length of database: 11,902,460
effective search space: 1142636160
effective search space used: 1142636160
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 57 (27.1 bits)

- SilkBase 1999-2023 -