GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002352-TA|BGIBMGA002352-PA|IPR006573|NEUZ,
IPR001841|Zinc finger, RING-type
         (592 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          25   1.3  

>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 345 GLRRGDELAVTLTLDGEVRVSRNGSNPVTVMHVDHTLRL-WAFVDVY-----GATQKVRM 398
           G +RG+E   T+T+ G V   ++      + +V++  R+ W ++D Y     GA    +M
Sbjct: 96  GAQRGNEQRCTVTMHGTV---QSYDKYDLLENVNNAARINWEYLDKYKPTPLGAVATEKM 152

Query: 399 LSTQTVAQTP 408
              + +A+TP
Sbjct: 153 FVARHLAETP 162


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.135    0.420 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,146
Number of Sequences: 429
Number of extensions: 7638
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 592
length of database: 140,377
effective HSP length: 62
effective length of query: 530
effective length of database: 113,779
effective search space: 60302870
effective search space used: 60302870
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)