GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002339-TA|BGIBMGA002339-PA|IPR000886|Endoplasmic
reticulum targeting sequence
         (321 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    27   0.14 

>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 27.5 bits (58), Expect = 0.14
 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 62  SFKDKIYAKEFLKSRGIERVIVPNLMM-PHLELKTSILVLVKILFEVTPTATKAAVP 117
           +F D++Y     K   I R +       PH        +L+K +++V PT T+  +P
Sbjct: 322 AFMDRLYFSNLDKDAFIHRTVDDYFFCSPHPHKVYDFELLIKGVYQVNPTKTRTNLP 378


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.140    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,134
Number of Sequences: 317
Number of extensions: 2203
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 321
length of database: 114,650
effective HSP length: 57
effective length of query: 264
effective length of database: 96,581
effective search space: 25497384
effective search space used: 25497384
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)