GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002331-TA|BGIBMGA002331-PA|IPR000437|Prokaryotic
membrane lipoprotein lipid attachment site
         (221 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.      27   0.58 

>AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.
          Length = 565

 Score = 26.6 bits (56), Expect = 0.58
 Identities = 12/31 (38%), Positives = 15/31 (48%)

Query: 11  IFATFFGSCLCIALIVGSLGTTHWVDARARK 41
           +FA     CLC+  +V  LG   WV  R  K
Sbjct: 183 LFALTLSVCLCVGGLVVLLGAFFWVYRRREK 213


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.326    0.137    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,809
Number of Sequences: 2123
Number of extensions: 6278
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 221
length of database: 516,269
effective HSP length: 62
effective length of query: 159
effective length of database: 384,643
effective search space: 61158237
effective search space used: 61158237
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 46 (22.6 bits)