GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002314-TA|BGIBMGA002314-PA|IPR006616|Protein of unknown
function DM9
         (248 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC2G2.16 |||mannose-6-phosphate isomerase |Schizosaccharomyces...    26   4.5  

>SPBC2G2.16 |||mannose-6-phosphate isomerase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 412

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/39 (33%), Positives = 17/39 (43%)

Query: 200 SGETLYVGRARYQLSVTPGKVHPSHKTCYIGFGGTEVAL 238
           SG+TL       + S+   KV P  K C  G  G  + L
Sbjct: 324 SGKTLLYDPPIEEFSILQTKVSPGQKQCIRGINGPSILL 362


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.316    0.134    0.427 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 865,323
Number of Sequences: 5004
Number of extensions: 30912
Number of successful extensions: 58
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 57
Number of HSP's gapped (non-prelim): 1
length of query: 248
length of database: 2,362,478
effective HSP length: 71
effective length of query: 177
effective length of database: 2,007,194
effective search space: 355273338
effective search space used: 355273338
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 53 (25.4 bits)