SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002309-TA|BGIBMGA002309-PA|IPR004301|Nucleoplasmin
         (187 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80442-5|AAB37668.2|  794|Caenorhabditis elegans Hypothetical pr...    30   1.2  

>U80442-5|AAB37668.2|  794|Caenorhabditis elegans Hypothetical
           protein T20F5.6 protein.
          Length = 794

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 21  DPEAKAEYPRSNKLVIRQALLGPDAKPDELNVIQVEAMSLQ 61
           + EA A   R+ K +   ALL PDA PD  N   ++ + +Q
Sbjct: 690 EAEANANGQRAPKNIEMPALLNPDANPDAPNFKNLQPLQVQ 730


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.310    0.127    0.351 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,166,815
Number of Sequences: 27539
Number of extensions: 85305
Number of successful extensions: 125
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 124
Number of HSP's gapped (non-prelim): 1
length of query: 187
length of database: 12,573,161
effective HSP length: 77
effective length of query: 110
effective length of database: 10,452,658
effective search space: 1149792380
effective search space used: 1149792380
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 57 (27.1 bits)

- SilkBase 1999-2023 -