SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002302-TA|BGIBMGA002302-PA|undefined
         (57 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY119272-1|AAM51132.1|  670|Drosophila melanogaster SD25109p pro...    25   9.5  

>AY119272-1|AAM51132.1|  670|Drosophila melanogaster SD25109p
           protein.
          Length = 670

 Score = 25.4 bits (53), Expect = 9.5
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 22  SHRPISVAIDSENGSLRFFEEIRADDNAGQ 51
           S++PI ++ +S N   +F +E  A+D+A +
Sbjct: 486 SNQPIVISEESRNIDAKFVDEAAAEDSANK 515


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.326    0.138    0.434 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,886,975
Number of Sequences: 52641
Number of extensions: 85430
Number of successful extensions: 195
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 194
Number of HSP's gapped (non-prelim): 1
length of query: 57
length of database: 24,830,863
effective HSP length: 38
effective length of query: 19
effective length of database: 22,830,505
effective search space: 433779595
effective search space used: 433779595
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -