GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002285-TA|BGIBMGA002285-PA|undefined
         (155 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    21   5.7  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    21   5.7  
DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    21   7.5  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    21   7.5  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    21   7.5  

>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 21.0 bits (42), Expect = 5.7
 Identities = 7/15 (46%), Positives = 8/15 (53%)

Query: 52  PKFHVKPPGTPGSHI 66
           P  H  PP TPG  +
Sbjct: 463 PHHHPHPPETPGPQV 477


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 21.0 bits (42), Expect = 5.7
 Identities = 13/40 (32%), Positives = 16/40 (40%)

Query: 89  FKQFEGFKDFTMNTAKSGLSAGEKTAFWVYNKLKLLSRRW 128
           F     F+ FT+   K   S   K  F  Y+KLK     W
Sbjct: 27  FNSLVRFRRFTIELDKVLESPRGKYEFSKYDKLKKKLEEW 66


>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 6/8 (75%), Positives = 6/8 (75%)

Query: 58  PPGTPGSH 65
           PPG PG H
Sbjct: 334 PPGVPGDH 341


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 6/8 (75%), Positives = 6/8 (75%)

Query: 58  PPGTPGSH 65
           PPG PG H
Sbjct: 334 PPGVPGDH 341


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 6/8 (75%), Positives = 6/8 (75%)

Query: 58  PPGTPGSH 65
           PPG PG H
Sbjct: 273 PPGVPGDH 280


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.135    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,570
Number of Sequences: 429
Number of extensions: 1631
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of query: 155
length of database: 140,377
effective HSP length: 53
effective length of query: 102
effective length of database: 117,640
effective search space: 11999280
effective search space used: 11999280
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 40 (20.2 bits)