GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002255-TA|BGIBMGA002255-PA|undefined
         (53 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81050-7|CAB02856.1|  713|Caenorhabditis elegans Hypothetical pr...    25   8.5  

>Z81050-7|CAB02856.1|  713|Caenorhabditis elegans Hypothetical
           protein C50B6.7 protein.
          Length = 713

 Score = 24.6 bits (51), Expect = 8.5
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 11  DKLPYLQVPNNNIRTVGLANNITRSVEHLPFVVYSHT 47
           D   YL VP+N+I  + L + +T      P   YS T
Sbjct: 491 DHTSYLSVPSNSIVAISLDSKLTPYTPPAPPSGYSTT 527


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.318    0.136    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,403,515
Number of Sequences: 27539
Number of extensions: 39352
Number of successful extensions: 73
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 72
Number of HSP's gapped (non-prelim): 1
length of query: 53
length of database: 12,573,161
effective HSP length: 34
effective length of query: 19
effective length of database: 11,636,835
effective search space: 221099865
effective search space used: 221099865
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)