GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002254-TA|BGIBMGA002254-PA|undefined
         (189 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          23   2.1  

>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 22.6 bits (46), Expect = 2.1
 Identities = 15/72 (20%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 84  GFSHEVDHPKNVPNYFTVDNVKHNTESANDDAAYILYHLLRNTNNNDHS--DFKEAKDSL 141
           G  H  D      + FT+  ++HN +   D     +  + RNT  N       ++ +++L
Sbjct: 297 GVEHFEDVVHKKCSNFTLPEIQHNLDVLVDMCEQDIIRIDRNTRFNQDKIVALRQEQETL 356

Query: 142 RSALRARCQKVE 153
           +S ++     V+
Sbjct: 357 KSQVQRESDVVD 368


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.131    0.391 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,565
Number of Sequences: 317
Number of extensions: 1789
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 189
length of database: 114,650
effective HSP length: 53
effective length of query: 136
effective length of database: 97,849
effective search space: 13307464
effective search space used: 13307464
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.5 bits)
S2: 41 (20.6 bits)