BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002254-TA|BGIBMGA002254-PA|undefined
(189 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 2.1
>DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein.
Length = 822
Score = 22.6 bits (46), Expect = 2.1
Identities = 15/72 (20%), Positives = 31/72 (43%), Gaps = 2/72 (2%)
Query: 84 GFSHEVDHPKNVPNYFTVDNVKHNTESANDDAAYILYHLLRNTNNNDHS--DFKEAKDSL 141
G H D + FT+ ++HN + D + + RNT N ++ +++L
Sbjct: 297 GVEHFEDVVHKKCSNFTLPEIQHNLDVLVDMCEQDIIRIDRNTRFNQDKIVALRQEQETL 356
Query: 142 RSALRARCQKVE 153
+S ++ V+
Sbjct: 357 KSQVQRESDVVD 368
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.315 0.131 0.391
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,565
Number of Sequences: 317
Number of extensions: 1789
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 189
length of database: 114,650
effective HSP length: 53
effective length of query: 136
effective length of database: 97,849
effective search space: 13307464
effective search space used: 13307464
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.5 bits)
S2: 41 (20.6 bits)
- SilkBase 1999-2023 -