SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002236-TA|BGIBMGA002236-PA|undefined
         (581 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    25   2.3  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     23   9.2  

>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
            protein.
          Length = 1124

 Score = 24.6 bits (51), Expect = 2.3
 Identities = 8/15 (53%), Positives = 12/15 (80%)

Query: 18   GTSNDSWTSGSICSQ 32
            G+SN SWT+G++  Q
Sbjct: 1074 GSSNGSWTAGTVSQQ 1088


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 22.6 bits (46), Expect = 9.2
 Identities = 11/43 (25%), Positives = 21/43 (48%)

Query: 479 RPEKALILGFMAGSRDNPCPNLGNIVTIKLSENIENVLQSDDT 521
           +P++ L L  +  +      +L N V    + N+ N+L  D+T
Sbjct: 473 QPQEQLTLSKVTSNYHEEFQSLNNAVGEMEATNVTNILSMDNT 515


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.132    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 128,999
Number of Sequences: 429
Number of extensions: 4591
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 2
length of query: 581
length of database: 140,377
effective HSP length: 61
effective length of query: 520
effective length of database: 114,208
effective search space: 59388160
effective search space used: 59388160
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -