GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002235-TA|BGIBMGA002235-PA|IPR011496|Hyaluronidase
eukaryotic/prokaryotic
         (857 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   7.9  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 663 LSPDLCMVLEDDGSFTHSDATTPDSEPSDPDN 694
           L P +   +++    T+ D   PDS+P  PD+
Sbjct: 639 LEPPIMPRVQNATDTTNFDEYPPDSDPPPPDD 670


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.133    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 210,876
Number of Sequences: 429
Number of extensions: 8277
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 857
length of database: 140,377
effective HSP length: 64
effective length of query: 793
effective length of database: 112,921
effective search space: 89546353
effective search space used: 89546353
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 48 (23.4 bits)