GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002233-TA|BGIBMGA002233-PA|undefined
         (179 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces...    25   8.5  

>SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 995

 Score = 24.6 bits (51), Expect = 8.5
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 13  LEFYVVLRVSGKKLVPIFMPAIQEPNGLVRSD 44
           +EF+  L+ S +  VPI   AI   N + RSD
Sbjct: 394 MEFFNSLQQSNQHYVPIIDAAIYAANPINRSD 425


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.321    0.137    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 606,454
Number of Sequences: 5004
Number of extensions: 18557
Number of successful extensions: 23
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 1
length of query: 179
length of database: 2,362,478
effective HSP length: 69
effective length of query: 110
effective length of database: 2,017,202
effective search space: 221892220
effective search space used: 221892220
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)