GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002224-TA|BGIBMGA002224-PA|undefined
         (407 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    23   5.2  

>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 156 FPNRTYFAP-FAYKTELNVRKFRLEDLARLNSTEEVYTNKPWFQFLKQRWSSNFD 209
           F N T  A  F    EL++ +  L     LN+T++++ N P  Q L    +S ++
Sbjct: 232 FNNITSVAKQFFRPVELSLMQLYLGHNKLLNATKDLFGNMPHLQVLDLSHNSLYE 286


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.137    0.435 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,243
Number of Sequences: 317
Number of extensions: 4487
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 407
length of database: 114,650
effective HSP length: 58
effective length of query: 349
effective length of database: 96,264
effective search space: 33596136
effective search space used: 33596136
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)