BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002223-TA|BGIBMGA002223-PA|undefined
(350 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.5
>AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor
protein protein.
Length = 585
Score = 23.4 bits (48), Expect = 2.5
Identities = 9/32 (28%), Positives = 18/32 (56%)
Query: 310 MEMDYERIDINQCPPSPGNDRPNKFASTARCK 341
+E ++ + N+CP GN R ++ +T C+
Sbjct: 481 LEKQRQQCNQNKCPVKRGNGRCDEECNTYACE 512
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.321 0.135 0.431
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,148
Number of Sequences: 317
Number of extensions: 4612
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 350
length of database: 114,650
effective HSP length: 57
effective length of query: 293
effective length of database: 96,581
effective search space: 28298233
effective search space used: 28298233
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -