BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002214-TA|BGIBMGA002214-PA|IPR001680|WD-40 repeat,
IPR011046|WD40-like
(516 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 25 1.5
>DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine
receptor alpha1subunit protein.
Length = 601
Score = 25.0 bits (52), Expect = 1.5
Identities = 12/44 (27%), Positives = 26/44 (59%), Gaps = 3/44 (6%)
Query: 19 QDVNMRLKRFFGSTMKKTVDAAKSLAQEVSHARHKEDVADIADD 62
+DV+ ++ ++KT+D A+ +AQ HA++K+ + +D
Sbjct: 498 EDVSPTFEKPLVREIEKTIDDARFIAQ---HAKNKDKFESVEED 538
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.321 0.134 0.419
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,850
Number of Sequences: 429
Number of extensions: 6199
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 516
length of database: 140,377
effective HSP length: 61
effective length of query: 455
effective length of database: 114,208
effective search space: 51964640
effective search space used: 51964640
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -