BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002206-TA|BGIBMGA002206-PA|undefined
(225 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.5
>AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor
candidate 15 protein.
Length = 455
Score = 23.4 bits (48), Expect = 1.5
Identities = 10/34 (29%), Positives = 18/34 (52%)
Query: 3 IIHVFIAITFMKYSKCYVIEDSGKVDAQKQLLRK 36
+ H+ + F+ C+++E G + KQLL K
Sbjct: 120 VAHLLFLVIFVLNIWCWIVEIGGWLAFTKQLLIK 153
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.319 0.136 0.405
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 56,391
Number of Sequences: 317
Number of extensions: 2476
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 225
length of database: 114,650
effective HSP length: 55
effective length of query: 170
effective length of database: 97,215
effective search space: 16526550
effective search space used: 16526550
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 42 (21.0 bits)
- SilkBase 1999-2023 -