SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002193-TA|BGIBMGA002193-PA|undefined
         (52 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z70271-3|CAA94234.1|  358|Caenorhabditis elegans Hypothetical pr...    27   1.6  

>Z70271-3|CAA94234.1|  358|Caenorhabditis elegans Hypothetical
          protein W08D2.6 protein.
          Length = 358

 Score = 27.1 bits (57), Expect = 1.6
 Identities = 10/37 (27%), Positives = 20/37 (54%)

Query: 1  MERIRMVSMVCIIVPEWLQVKDLWLDSTDTQLSVRKD 37
          +  I ++S + ++   +  V+D W +  D  + VRKD
Sbjct: 23 LSAIALISCLLVLSSVYRNVQDYWTELDDQMVEVRKD 59


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.325    0.137    0.453 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,209,922
Number of Sequences: 27539
Number of extensions: 29580
Number of successful extensions: 78
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 77
Number of HSP's gapped (non-prelim): 1
length of query: 52
length of database: 12,573,161
effective HSP length: 33
effective length of query: 19
effective length of database: 11,664,374
effective search space: 221623106
effective search space used: 221623106
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -