Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002183-TA|BGIBMGA002183-PA|undefined
         (238 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    24   3.4  
AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.    23   7.9  

>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 9/12 (75%), Positives = 10/12 (83%)

Query: 119 AASTGPSQPTHR 130
           AA+TGP  PTHR
Sbjct: 913 AAATGPPPPTHR 924


>AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.
          Length = 1201

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 93  NFGYHNPRILADKSTSLTVVPQQASIAASTGP 124
           NF Y    +L+D+ T L    +QA +   TGP
Sbjct: 40  NFFYAIQFVLSDEFTHLRPEQRQALLHEGTGP 71


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.323    0.131    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 221,163
Number of Sequences: 2123
Number of extensions: 8436
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 2
length of query: 238
length of database: 516,269
effective HSP length: 62
effective length of query: 176
effective length of database: 384,643
effective search space: 67697168
effective search space used: 67697168
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 47 (23.0 bits)