GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002148-TA|BGIBMGA002148-PA|IPR003593|AAA ATPase,
IPR013602|Dynein heavy chain, N-terminal region 2, IPR011704|ATPase
associated with various cellular activities, AAA-5, IPR004273|Dynein
heavy chain
         (3112 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    27   3.2  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase protein.
          Length = 580

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 2928 PQNWLKVSWESATLGFWYTELLEREQQYRIWLKNGRPNAFWMTGFFNPQGFLTAMRQEVT 2987
            P NWL V W SA   + + E  ER+Q Y      G+P+  + +   + Q     +   + 
Sbjct: 161  PNNWLSVFWGSA---WQWNE--ERKQYYLHQFATGQPDLNYRSAALD-QEMKNVLTFWMN 214

Query: 2988 RSHKGWALDSV 2998
            R   G+ +D++
Sbjct: 215  RGVDGFRIDAI 225


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 849,174
Number of Sequences: 429
Number of extensions: 36549
Number of successful extensions: 127
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 127
Number of HSP's gapped (non-prelim): 1
length of query: 3112
length of database: 140,377
effective HSP length: 71
effective length of query: 3041
effective length of database: 109,918
effective search space: 334260638
effective search space used: 334260638
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 52 (25.0 bits)