SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002146-TA|BGIBMGA002146-PA|undefined
         (99 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY565835-1|AAS74845.1|  107|Drosophila melanogaster 5-HT1B protein.    27   3.0  

>AY565835-1|AAS74845.1|  107|Drosophila melanogaster 5-HT1B
          protein.
          Length = 107

 Score = 27.5 bits (58), Expect = 3.0
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 19 AAGQIDIKGSIDEVNINNPIGNQSEVIAIQGYLTE 53
          AAG +D+  SI E+ +   + N+S  I + G LT+
Sbjct: 10 AAGDVDVPASILEIELPAILLNESLFIELNGNLTQ 44


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.320    0.141    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,878,692
Number of Sequences: 52641
Number of extensions: 173065
Number of successful extensions: 527
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 526
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 24,830,863
effective HSP length: 73
effective length of query: 26
effective length of database: 20,988,070
effective search space: 545689820
effective search space used: 545689820
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)

- SilkBase 1999-2023 -