GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002144-TA|BGIBMGA002144-PA|IPR013594|Dynein heavy chain,
N-terminal region 1
         (1013 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor ...    23   7.9  

>Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor
           5-like protein protein.
          Length = 162

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 879 KKAAQQIRPTEINPDFEFLIAEDDPQSSGAASSTNESTSSGQQDWSAVWE 928
           K++ +  RP   N D     ++ D Q+    +S NE++ +G  D    W+
Sbjct: 75  KRSKRSKRP---NGDTNGDTSQVDDQNESLEASVNENSKNGDDDEGHEWQ 121


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.135    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 220,494
Number of Sequences: 317
Number of extensions: 9273
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 1013
length of database: 114,650
effective HSP length: 64
effective length of query: 949
effective length of database: 94,362
effective search space: 89549538
effective search space used: 89549538
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 48 (23.4 bits)