SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002143-TA|BGIBMGA002143-PA|undefined
         (175 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor |Schizo...    25   6.3  
SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces p...    25   8.3  

>SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 512

 Score = 25.0 bits (52), Expect = 6.3
 Identities = 14/57 (24%), Positives = 24/57 (42%)

Query: 67  FVFAAPACRASRRTAIRTALGCGQGGSQKIEEWNVKDILWYIGHEPKRNPQTRWAIT 123
           FV    A +   + A      C + G  + +   V+  +WY     KRNP+  W ++
Sbjct: 366 FVLYHIAAKYGLKDAQLRVARCFELGQLECDINLVRSFVWYRRLARKRNPEAMWKLS 422


>SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 509

 Score = 24.6 bits (51), Expect = 8.3
 Identities = 8/12 (66%), Positives = 12/12 (100%)

Query: 146 AVTEDQLKWMSA 157
           A+TEDQL+W+S+
Sbjct: 363 AITEDQLEWLSS 374


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.326    0.137    0.473 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 754,270
Number of Sequences: 5004
Number of extensions: 25224
Number of successful extensions: 57
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 55
Number of HSP's gapped (non-prelim): 2
length of query: 175
length of database: 2,362,478
effective HSP length: 68
effective length of query: 107
effective length of database: 2,022,206
effective search space: 216376042
effective search space used: 216376042
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -