SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002143-TA|BGIBMGA002143-PA|undefined
         (175 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF203335-1|AAF19830.1|  175|Anopheles gambiae immune-responsive ...    25   1.7  

>AF203335-1|AAF19830.1|  175|Anopheles gambiae immune-responsive
           serine protease-relatedprotein ISPR20 protein.
          Length = 175

 Score = 24.6 bits (51), Expect = 1.7
 Identities = 12/40 (30%), Positives = 18/40 (45%)

Query: 130 EKRSKEKPWFGKTIAGAVTEDQLKWMSALMFAEHTSILPT 169
           E    E PW    +A   TE  LK++S     +  ++L T
Sbjct: 135 ESEYGEYPWTVAILARTKTESALKYLSGGALIDRAAVLTT 174


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.326    0.137    0.473 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,326
Number of Sequences: 2123
Number of extensions: 5787
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 175
length of database: 516,269
effective HSP length: 60
effective length of query: 115
effective length of database: 388,889
effective search space: 44722235
effective search space used: 44722235
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -