BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002143-TA|BGIBMGA002143-PA|undefined
(175 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 25 1.7
>AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive
serine protease-relatedprotein ISPR20 protein.
Length = 175
Score = 24.6 bits (51), Expect = 1.7
Identities = 12/40 (30%), Positives = 18/40 (45%)
Query: 130 EKRSKEKPWFGKTIAGAVTEDQLKWMSALMFAEHTSILPT 169
E E PW +A TE LK++S + ++L T
Sbjct: 135 ESEYGEYPWTVAILARTKTESALKYLSGGALIDRAAVLTT 174
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.326 0.137 0.473
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,326
Number of Sequences: 2123
Number of extensions: 5787
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 175
length of database: 516,269
effective HSP length: 60
effective length of query: 115
effective length of database: 388,889
effective search space: 44722235
effective search space used: 44722235
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -