BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002139-TA|BGIBMGA002139-PA|undefined
(239 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 26 0.86
>AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase
subunit 1 protein.
Length = 688
Score = 26.2 bits (55), Expect = 0.86
Identities = 13/45 (28%), Positives = 25/45 (55%)
Query: 100 EQLVVPAGLPRNLEAALQRYGTASFKANMATVLDPNGKLSNSLTY 144
+ ++VP GLP ++ L T + ++A LDPN S++ ++
Sbjct: 588 QHMLVPKGLPEGVQFDLFAMVTDFEQDSVAQELDPNAPCSDAHSF 632
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.315 0.131 0.383
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 215,496
Number of Sequences: 2123
Number of extensions: 7491
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 239
length of database: 516,269
effective HSP length: 62
effective length of query: 177
effective length of database: 384,643
effective search space: 68081811
effective search space used: 68081811
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 47 (23.0 bits)
- SilkBase 1999-2023 -