BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002139-TA|BGIBMGA002139-PA|undefined
(239 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.4
>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
Length = 1946
Score = 22.2 bits (45), Expect = 4.4
Identities = 12/36 (33%), Positives = 18/36 (50%)
Query: 10 TNATAASRRGGALVADRVQCYAQAEDTGTGTGRWKV 45
TNA+A SR G + + Y++ G G+G V
Sbjct: 1767 TNASAHSRSGSQSMPRQNGRYSRVPSQGGGSGTHNV 1802
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.315 0.131 0.383
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,350
Number of Sequences: 429
Number of extensions: 1996
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 239
length of database: 140,377
effective HSP length: 56
effective length of query: 183
effective length of database: 116,353
effective search space: 21292599
effective search space used: 21292599
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -