SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002130-TA|BGIBMGA002130-PA|undefined
         (68 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    23   0.37 

>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 22.6 bits (46), Expect = 0.37
 Identities = 11/37 (29%), Positives = 18/37 (48%)

Query: 15  IMWFRKLRASRPVPQRPELGPAIIVDGAIAHVEDSII 51
           + WF     + P+    + GP   VDG+I  V  S++
Sbjct: 193 LAWFIAALFTSPILAITQYGPEEYVDGSIVFVCFSLV 229


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,137
Number of Sequences: 317
Number of extensions: 519
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 68
length of database: 114,650
effective HSP length: 44
effective length of query: 24
effective length of database: 100,702
effective search space:  2416848
effective search space used:  2416848
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)
S2: 35 (18.2 bits)

- SilkBase 1999-2023 -