GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002124-TA|BGIBMGA002124-PA|undefined
         (121 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4WDV8 Cluster: Putative uncharacterized protein; n=2; ...    36   0.16 

>UniRef50_Q4WDV8 Cluster: Putative uncharacterized protein; n=2;
           Trichocomaceae|Rep: Putative uncharacterized protein -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 577

 Score = 36.3 bits (80), Expect = 0.16
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 76  MTANLGLFICRGFVLSCEMTKAQYLRREWLWELLVVSLAHL 116
           +TAN    +C+G VL    T   Y+R  WLW LL + L  L
Sbjct: 458 LTANARNRVCQGAVLGDAWTNVSYIRIRWLWMLLPIVLVVL 498


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.328    0.144    0.498 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,824,088
Number of Sequences: 1657284
Number of extensions: 2337640
Number of successful extensions: 3720
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3719
Number of HSP's gapped (non-prelim): 1
length of query: 121
length of database: 575,637,011
effective HSP length: 90
effective length of query: 31
effective length of database: 426,481,451
effective search space: 13220924981
effective search space used: 13220924981
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 66 (30.7 bits)