SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002107-TA|BGIBMGA002107-PA|undefined
         (787 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276486-1|CAB90818.1|  364|Anopheles gambiae serine protease pr...    25   7.7  

>AJ276486-1|CAB90818.1|  364|Anopheles gambiae serine protease
           protein.
          Length = 364

 Score = 25.0 bits (52), Expect = 7.7
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 305 GFDEKDDRKRSKNPRTLSGPKLVHEAKN-ISAVAS 338
           G+ E +DR+ S   + +  P L HEA N + AVA+
Sbjct: 253 GWGETEDRRPSDTQKHVELPGLEHEACNSVYAVAN 287


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.311    0.127    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 623,095
Number of Sequences: 2123
Number of extensions: 21672
Number of successful extensions: 42
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 42
Number of HSP's gapped (non-prelim): 1
length of query: 787
length of database: 516,269
effective HSP length: 69
effective length of query: 718
effective length of database: 369,782
effective search space: 265503476
effective search space used: 265503476
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -