BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002107-TA|BGIBMGA002107-PA|undefined
(787 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 25 7.7
>AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease
protein.
Length = 364
Score = 25.0 bits (52), Expect = 7.7
Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Query: 305 GFDEKDDRKRSKNPRTLSGPKLVHEAKN-ISAVAS 338
G+ E +DR+ S + + P L HEA N + AVA+
Sbjct: 253 GWGETEDRRPSDTQKHVELPGLEHEACNSVYAVAN 287
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.311 0.127 0.362
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 623,095
Number of Sequences: 2123
Number of extensions: 21672
Number of successful extensions: 42
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 42
Number of HSP's gapped (non-prelim): 1
length of query: 787
length of database: 516,269
effective HSP length: 69
effective length of query: 718
effective length of database: 369,782
effective search space: 265503476
effective search space used: 265503476
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -