SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002105-TA|BGIBMGA002105-PA|IPR000408|Regulator of
chromosome condensation, RCC1, IPR009091|Regulator of chromosome
condensation/beta-lactamase-inhibitor protein II
         (480 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsiv...    25   5.9  

>AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsive
           protein 1 protein.
          Length = 447

 Score = 24.6 bits (51), Expect = 5.9
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 295 VDLSCGNNHTVAIDSMKRAFSWGFGGFGRLGHAEQKDENVPRLIKYFDTV-GRGVRSVHC 353
           +DL  G +H  A+ ++KR +  G   F  +G+     E  P   KY   +   G R+   
Sbjct: 86  LDLDSGKSHFRAVTTLKRRYP-GLKVFLSVGNYRDLGEEKP-FEKYLTLLESGGSRTAFV 143

Query: 354 GGTYSL 359
              YSL
Sbjct: 144 NSAYSL 149


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.135    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 522,496
Number of Sequences: 2123
Number of extensions: 23743
Number of successful extensions: 26
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 26
Number of HSP's gapped (non-prelim): 1
length of query: 480
length of database: 516,269
effective HSP length: 67
effective length of query: 413
effective length of database: 374,028
effective search space: 154473564
effective search space used: 154473564
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 50 (24.2 bits)

- SilkBase 1999-2023 -