SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002104-TA|BGIBMGA002104-PA|undefined
         (1852 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    26   2.1  

>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 26.2 bits (55), Expect = 2.1
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 677 IPLPEGRTP--SEKALIKKITGITPIKVPSEKLRKAKAAGFLTPLEGKTTEQKEKILRGL 734
           IP P+  +P  +EK  +   T  TP   P E+L  +K A         T+ Q  ++ R  
Sbjct: 77  IPSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTPSKDASSKRIXTAFTSTQLLELEREF 136

Query: 735 AKN 737
           A N
Sbjct: 137 ASN 139


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.310    0.129    0.359 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,283
Number of Sequences: 317
Number of extensions: 15636
Number of successful extensions: 28
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 28
Number of HSP's gapped (non-prelim): 1
length of query: 1852
length of database: 114,650
effective HSP length: 67
effective length of query: 1785
effective length of database: 93,411
effective search space: 166738635
effective search space used: 166738635
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 50 (24.2 bits)

- SilkBase 1999-2023 -