SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002102-TA|BGIBMGA002102-PA|undefined
         (222 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom...    25   8.9  

>SPAC1556.02c |sdh1||succinate dehydrogenase
           Sdh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 641

 Score = 25.0 bits (52), Expect = 8.9
 Identities = 11/33 (33%), Positives = 16/33 (48%)

Query: 159 LALRLYSTLLIICTTTYEAEGDGSARAARPTIP 191
           LA   Y      CT+ +   GDG+A  +R  +P
Sbjct: 247 LATGGYGRAYFSCTSAHTCTGDGNAMVSRAGLP 279


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.328    0.140    0.440 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 814,289
Number of Sequences: 5004
Number of extensions: 26602
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 60
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 2,362,478
effective HSP length: 70
effective length of query: 152
effective length of database: 2,012,198
effective search space: 305854096
effective search space used: 305854096
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -