BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002102-TA|BGIBMGA002102-PA|undefined
(222 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 25 8.9
>SPAC1556.02c |sdh1||succinate dehydrogenase
Sdh1|Schizosaccharomyces pombe|chr 1|||Manual
Length = 641
Score = 25.0 bits (52), Expect = 8.9
Identities = 11/33 (33%), Positives = 16/33 (48%)
Query: 159 LALRLYSTLLIICTTTYEAEGDGSARAARPTIP 191
LA Y CT+ + GDG+A +R +P
Sbjct: 247 LATGGYGRAYFSCTSAHTCTGDGNAMVSRAGLP 279
Database: spombe
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.328 0.140 0.440
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 814,289
Number of Sequences: 5004
Number of extensions: 26602
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 60
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 2,362,478
effective HSP length: 70
effective length of query: 152
effective length of database: 2,012,198
effective search space: 305854096
effective search space used: 305854096
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -