SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002099-TA|BGIBMGA002099-PA|IPR011032|GroES-like,
IPR002085|Alcohol dehydrogenase superfamily, zinc-containing,
IPR013154|Alcohol dehydrogenase GroES-like
         (380 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF457546-1|AAL68776.1|  182|Anopheles gambiae 30 kDa protein pro...    26   2.0  

>AF457546-1|AAL68776.1|  182|Anopheles gambiae 30 kDa protein
           protein.
          Length = 182

 Score = 25.8 bits (54), Expect = 2.0
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 89  DGALFPGYEVAGIIDAIGKAAERTDELKEGA 119
           D A+  G E AG  DA+  A + T+E K+ A
Sbjct: 105 DSAMKEGEEGAGSDDAVSGADDETEESKDDA 135


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.137    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 379,955
Number of Sequences: 2123
Number of extensions: 14818
Number of successful extensions: 60
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 1
length of query: 380
length of database: 516,269
effective HSP length: 65
effective length of query: 315
effective length of database: 378,274
effective search space: 119156310
effective search space used: 119156310
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 49 (23.8 bits)

- SilkBase 1999-2023 -