GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002081-TA|BGIBMGA002081-PA|IPR011765|Peptidase M16,
N-terminal, IPR007863|Peptidase M16, C-terminal
         (464 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    23   3.4  

>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 23.4 bits (48), Expect = 3.4
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 350 EDMLNNIQDYWMKMCVSVHYTDLERAKN-LAKLK 382
           ED    + DY++KM    H  D+   K  L KL+
Sbjct: 58  EDFDQKVMDYFIKMVKQKHKKDIRADKKALQKLR 91


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.137    0.432 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,780
Number of Sequences: 317
Number of extensions: 5193
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 464
length of database: 114,650
effective HSP length: 59
effective length of query: 405
effective length of database: 95,947
effective search space: 38858535
effective search space used: 38858535
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)