GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002081-TA|BGIBMGA002081-PA|IPR011765|Peptidase M16,
N-terminal, IPR007863|Peptidase M16, C-terminal
         (464 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             24   2.3  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 24.2 bits (50), Expect = 2.3
 Identities = 9/32 (28%), Positives = 18/32 (56%)

Query: 184 LAQSVIGPSKNIQNFDSQLLSSFMTDHYQPYK 215
           + Q  +    ++QN    L S+ + DH++PY+
Sbjct: 133 IKQETLQRHHHLQNHHHHLQSTAVQDHHRPYQ 164


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.322    0.137    0.432 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 136,813
Number of Sequences: 429
Number of extensions: 5621
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 464
length of database: 140,377
effective HSP length: 60
effective length of query: 404
effective length of database: 114,637
effective search space: 46313348
effective search space used: 46313348
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)