GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002057-TA|BGIBMGA002057-PA|undefined
         (109 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10)                  27   3.3  

>SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10)
          Length = 507

 Score = 27.1 bits (57), Expect = 3.3
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 6   GRDLSILISAARPSIALVRRLSWANSRIIGLNFSLLSL 43
           GR   + I + +PS ++V + +W  S I+  N   L L
Sbjct: 364 GRSYGLAILSVKPSCSVVTKHTWILSSILSFNLIFLIL 401


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.317    0.133    0.363 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,474,934
Number of Sequences: 59808
Number of extensions: 56186
Number of successful extensions: 99
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 97
Number of HSP's gapped (non-prelim): 2
length of query: 109
length of database: 16,821,457
effective HSP length: 72
effective length of query: 37
effective length of database: 12,515,281
effective search space: 463065397
effective search space used: 463065397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)