BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002053-TA|BGIBMGA002053-PA|IPR004853|Protein of unknown
function DUF250
(330 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 25 2.9
>AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding
protein AgamOBP50 protein.
Length = 166
Score = 25.0 bits (52), Expect = 2.9
Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
Query: 240 MSCIMGFVLSYSVMLCTQYNSALTTTIIG-CLKNILVTY 277
++C+ F+ S V C Q + LT G CL+ I Y
Sbjct: 13 LTCLSPFLQSIKVASCCQLEAFLTLPTYGNCLQTIAEKY 51
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.326 0.138 0.417
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 287,655
Number of Sequences: 2123
Number of extensions: 10029
Number of successful extensions: 21
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 21
Number of HSP's gapped (non-prelim): 1
length of query: 330
length of database: 516,269
effective HSP length: 64
effective length of query: 266
effective length of database: 380,397
effective search space: 101185602
effective search space used: 101185602
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 48 (23.4 bits)
- SilkBase 1999-2023 -