GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002053-TA|BGIBMGA002053-PA|IPR004853|Protein of unknown
function DUF250
         (330 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY330177-1|AAQ16283.1|  166|Anopheles gambiae odorant-binding pr...    25   2.9  

>AY330177-1|AAQ16283.1|  166|Anopheles gambiae odorant-binding
           protein AgamOBP50 protein.
          Length = 166

 Score = 25.0 bits (52), Expect = 2.9
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 240 MSCIMGFVLSYSVMLCTQYNSALTTTIIG-CLKNILVTY 277
           ++C+  F+ S  V  C Q  + LT    G CL+ I   Y
Sbjct: 13  LTCLSPFLQSIKVASCCQLEAFLTLPTYGNCLQTIAEKY 51


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.326    0.138    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 287,655
Number of Sequences: 2123
Number of extensions: 10029
Number of successful extensions: 21
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 21
Number of HSP's gapped (non-prelim): 1
length of query: 330
length of database: 516,269
effective HSP length: 64
effective length of query: 266
effective length of database: 380,397
effective search space: 101185602
effective search space used: 101185602
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 48 (23.4 bits)