GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002037-TA|BGIBMGA002037-PA|undefined
         (70 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RTC2 Cluster: Putative uncharacterized protein PY0007...    30   8.0  

>UniRef50_Q7RTC2 Cluster: Putative uncharacterized protein PY00072;
            n=9; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
            protein PY00072 - Plasmodium yoelii yoelii
          Length = 3663

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 22   DRAIGGITIHTRQDNLY--GRGVRNLGDQIPPKMLVQKATGNHCT 64
            D+  G  T+ + ++NLY  G G + LG   PP  + +  +GN+ T
Sbjct: 2469 DKGTGKQTLGSMRENLYDKGTGKQRLGSISPPNSVEESDSGNNIT 2513


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,451,435
Number of Sequences: 1657284
Number of extensions: 2585645
Number of successful extensions: 3941
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3941
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 575,637,011
effective HSP length: 49
effective length of query: 21
effective length of database: 494,430,095
effective search space: 10383031995
effective search space used: 10383031995
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 65 (30.3 bits)