SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002025-TA|BGIBMGA002025-PA|undefined
         (165 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF492464-1|AAM11657.1|  803|Anopheles gambiae beta nu integrin s...    24   2.8  
AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein ...    23   6.4  

>AF492464-1|AAM11657.1|  803|Anopheles gambiae beta nu integrin
           subunit AgBnu protein.
          Length = 803

 Score = 23.8 bits (49), Expect = 2.8
 Identities = 8/12 (66%), Positives = 10/12 (83%)

Query: 28  CEKNKMPLEVGE 39
           CEKNK P+E+ E
Sbjct: 468 CEKNKKPMELSE 479


>AF283269-1|AAG15374.1|  114|Anopheles gambiae ribosomal protein S26
           protein.
          Length = 114

 Score = 22.6 bits (46), Expect = 6.4
 Identities = 17/54 (31%), Positives = 23/54 (42%)

Query: 86  IRSCGASASIKNGGVGTSSVLIVLHADSNQEIRSVIDIWGVKNYEKTTRRALNP 139
           I    A   I +  V +S VL  L+A  +  +   I    V+N  K TRR   P
Sbjct: 43  IVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTP 96


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,760
Number of Sequences: 2123
Number of extensions: 5648
Number of successful extensions: 25
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 2
length of query: 165
length of database: 516,269
effective HSP length: 59
effective length of query: 106
effective length of database: 391,012
effective search space: 41447272
effective search space used: 41447272
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -