GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002010-TA|BGIBMGA002010-PA|IPR006603|Cystinosin/ERS1p
repeat
         (260 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase p...    23   6.7  

>AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 6   YLIEIFANALSTMTILSSLFLKVPQIMSIREKRSAEG 42
           Y IE FAN L+     S L   +P+    +  RS++G
Sbjct: 245 YNIERFANGLARTLSFSQLRESIPEAYFPKIVRSSDG 281


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.331    0.144    0.425 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,635
Number of Sequences: 2123
Number of extensions: 8817
Number of successful extensions: 51
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 50
Number of HSP's gapped (non-prelim): 1
length of query: 260
length of database: 516,269
effective HSP length: 63
effective length of query: 197
effective length of database: 382,520
effective search space: 75356440
effective search space used: 75356440
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.9 bits)
S2: 47 (23.0 bits)