GeneModel BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002006-TA|BGIBMGA002006-PA|undefined
         (110 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-769|AAN13390.1|  778|Drosophila melanogaster CG8007-PB,...    29   0.99 

>AE014297-769|AAN13390.1|  778|Drosophila melanogaster CG8007-PB,
           isoform B protein.
          Length = 778

 Score = 29.5 bits (63), Expect = 0.99
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 12  DSDDEEAATIEQPDLAAKKPTFHSATEVKP 41
           D DDEE  + +Q D   K    HS TE+ P
Sbjct: 408 DDDDEEEESAQQKDQQTKSKICHSDTELDP 437


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.321    0.136    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,492,098
Number of Sequences: 52641
Number of extensions: 207548
Number of successful extensions: 455
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 454
Number of HSP's gapped (non-prelim): 1
length of query: 110
length of database: 24,830,863
effective HSP length: 75
effective length of query: 35
effective length of database: 20,882,788
effective search space: 730897580
effective search space used: 730897580
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 55 (26.2 bits)