Silkworm BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001981-TA|BGIBMGA001981-PA|undefined
         (805 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC162.07 |ent1||epsin|Schizosaccharomyces pombe|chr 3|||Manual       27   7.8  

>SPCC162.07 |ent1||epsin|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 706

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 29 WRNQNTPMTEKCRQLWEQLGALWVSIVLDPGSNKHHRLQWRHLLEKWSAVEVC 81
          W    T M E     ++Q   L V  ++D   N   +  WRH+ +  S +E C
Sbjct: 35 WGPSGTAMAEIAELTYDQNEMLEVMDIIDRRLNDKGK-NWRHVFKSLSLLEYC 86


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.321    0.132    0.422 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,918,075
Number of Sequences: 5004
Number of extensions: 103428
Number of successful extensions: 190
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 190
Number of HSP's gapped (non-prelim): 1
length of query: 805
length of database: 2,362,478
effective HSP length: 79
effective length of query: 726
effective length of database: 1,967,162
effective search space: 1428159612
effective search space used: 1428159612
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 58 (27.5 bits)