SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001981-TA|BGIBMGA001981-PA|undefined
         (805 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.       24   3.6  
AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory recept...    24   4.7  

>AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.
          Length = 199

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%)

Query: 300 SLVCAHMDSGACQSGGATCALSHTQRCIGRDSRCWTGWTL 339
           SL  +H D   C++GG    L  T  C  R    W G TL
Sbjct: 142 SLKDSHCDHTTCKNGGTCQDLGKTFMC--RCPPDWEGTTL 179


>AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory receptor
           candidate 40 protein.
          Length = 373

 Score = 23.8 bits (49), Expect = 4.7
 Identities = 8/13 (61%), Positives = 10/13 (76%)

Query: 68  WRHLLEKWSAVEV 80
           W  L+EKWS VE+
Sbjct: 285 WPQLIEKWSRVEM 297


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.132    0.422 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,170
Number of Sequences: 317
Number of extensions: 5828
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 3
length of query: 805
length of database: 114,650
effective HSP length: 62
effective length of query: 743
effective length of database: 94,996
effective search space: 70582028
effective search space used: 70582028
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -