Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001980-TA|BGIBMGA001980-PA|undefined
         (128 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z71480-1|CAA96104.1|  209|Anopheles gambiae GSTD2 protein protein.     22   7.6  

>Z71480-1|CAA96104.1|  209|Anopheles gambiae GSTD2 protein protein.
          Length = 209

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 12/47 (25%), Positives = 20/47 (42%)

Query: 68  APPDDHRNIAFCRGLKLLEAGCVENVLQVGECPPATRLRLFTNMRLA 114
           A PD  + +AF + ++LL     E+    G       + LF  +  A
Sbjct: 122 AAPDGRKRLAFEKAVELLNIFLSEHEFVAGSKMTIADISLFATLATA 168


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.328    0.140    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,692
Number of Sequences: 2123
Number of extensions: 3667
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 128
length of database: 516,269
effective HSP length: 57
effective length of query: 71
effective length of database: 395,258
effective search space: 28063318
effective search space used: 28063318
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 44 (21.8 bits)