BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001980-TA|BGIBMGA001980-PA|undefined (128 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117203-3|CAB55101.1| 448|Caenorhabditis elegans Hypothetical ... 30 0.44 Z49912-5|CAA90136.1| 312|Caenorhabditis elegans Hypothetical pr... 28 1.8 >AL117203-3|CAB55101.1| 448|Caenorhabditis elegans Hypothetical protein Y48C3A.4 protein. Length = 448 Score = 30.3 bits (65), Expect = 0.44 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Query: 57 RDICMYSSLARAPPDDHRNIAFCRGLKLLEAGCVENVLQVGECPPATRLRLFTNMRLAHP 116 RD + + R ++H N + +AGC + L + + +++T+MR HP Sbjct: 256 RDKALQCGICRKKVENHENAMAVHVAEHADAGCYQCRLCGWQA--IDKYKIYTHMREEHP 313 Query: 117 RRINKNLDVCD 127 R+++ +D D Sbjct: 314 RKVDMFVDKRD 324 >Z49912-5|CAA90136.1| 312|Caenorhabditis elegans Hypothetical protein T24F1.1 protein. Length = 312 Score = 28.3 bits (60), Expect = 1.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 51 SFPRDERDICMYSSLARAPPDDHRNIAFCRGLK 83 +F R E D+ YS LA P + R A C+ K Sbjct: 137 TFKRREADVLRYSELAATPLQNERTNAVCQCFK 169 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.328 0.140 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,541,392 Number of Sequences: 27539 Number of extensions: 82770 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 138 Number of HSP's gapped (non-prelim): 2 length of query: 128 length of database: 12,573,161 effective HSP length: 74 effective length of query: 54 effective length of database: 10,535,275 effective search space: 568904850 effective search space used: 568904850 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -